Calmin antibody
| Name | Calmin antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335462 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Human, Mouse, Pig, Yeast |
| Antigen | The immunogen for Anti-CLMN Antibody: synthetic peptide directed towards the C terminal of human CLMN. Synthetic peptide located within the following region: LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | CLMN |
| Supplier Page | Shop |
Product images
WB Suggested Anti-CLMN Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver