CARS2 antibody

Name CARS2 antibody
Supplier Acris Antibodies
Catalog TA331742
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat
Antigen The immunogen for Anti-CARS2 Antibody is: synthetic peptide directed towards the N-terminal region of Human CARS2. Synthetic peptide located within the following region: GNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALW.
Description Rabbit Polyclonal
Gene CARS2
Supplier Page Shop

Product images