CCDC74A antibody
| Name | CCDC74A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA344341 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | The immunogen for anti-CCDC74A antibody: synthetic peptide directed towards the middle region of human CCDC74A. Synthetic peptide located within the following region: FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | CCDC74A |
| Supplier Page | Shop |
Product images
WB Suggested Anti-CCDC74A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate