CCDC74B antibody

Name CCDC74B antibody
Supplier Acris Antibodies
Catalog TA333310
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-CCDC74B Antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC74B. Synthetic peptide located within the following region: QHSEMLAKLHEEIEHLKRENKDLRYKLIMNQTSQKKDGPSGNHLSRASAP.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene CCDC74B
Supplier Page Shop

Product images