CCDC85A antibody
| Name | CCDC85A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332155 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Guinea Pig, Human, Mouse, Rat |
| Antigen | The immunogen for Anti-Ccdc85a Antibody is: synthetic peptide directed towards the middle region of Rat Ccdc85a. Synthetic peptide located within the following region: YSGMNESTLSYVRQLEARVRQLEEENRMLPQATQNRSQPPTRNSSNMEKG. |
| Description | Rabbit Polyclonal |
| Gene | CCDC85A |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Ccdc85a; Sample Tissue: Rat Lung lysates; Antibody Dilution: 1.0ug/ml