CCDC85A antibody
| Name | CCDC85A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332221 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-CCDC85A Antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC85A. Synthetic peptide located within the following region: AMLDHSNLIREVNRRLQLHLGEIRGLKDINQKLQEDNQELRDLCCFLDDD. |
| Description | Rabbit Polyclonal |
| Gene | CCDC85A |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: CCDC85A; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml