CCDC103 antibody
| Name | CCDC103 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334889 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for anti-CCDC103 antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC103. Synthetic peptide located within the following region: RAAVLGILCSLASTGRFTLNLSLLSRAERESCKGLFQKLQAMGNPRSVKE. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | CCDC103 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: CCDC103; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0 ug/ml