CCDC159 antibody
| Name | CCDC159 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334117 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-CCDC159 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC159. Synthetic peptide located within the following region: CRKILTKMKQQGHETAACPETEEIPQGASGCWKDDLQKELSDIWSAVHVL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | CCDC159 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: CCDC159; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0 ug/ml.