CENP-L antibody

Name CENP-L antibody
Supplier Acris Antibodies
Catalog TA335420
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat
Antigen The immunogen for Anti-CENPL Antibody is: synthetic peptide directed towards the N-terminal region of Human CENPL. Synthetic peptide located within the following region: AVEVGEDFNIKVIFSTLLGMKGTQRDPEAFLVQIVSKSQLPSENREGKVL.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene CENPL
Supplier Page Shop

Product images