CHIC1 antibody
| Name | CHIC1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335985 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Human, Mouse, Pig, Rat, Zebrafish |
| Antigen | The immunogen for Anti-CHIC1 Antibody: synthetic peptide directed towards the N terminal of human CHIC1. Synthetic peptide located within the following region: LRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CHIC1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-CHIC1 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate