CIITA / C2TA antibody
| Name | CIITA / C2TA antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341750 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human, Mouse, Rat |
| Antigen | The immunogen for anti-C2TA antibody: synthetic peptide directed towards the C terminal of mouse C2TA. Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN. |
| Description | Rabbit Polyclonal |
| Gene | Ciita |
| Supplier Page | Shop |
Product images
WB Suggested Anti-C2TA Antibody Titration: 0.125 ug/ml; ELISA Titer: 1:62500; Positive Control: NIH/3T3 cell lysate