CITED4 antibody
| Name | CITED4 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342331 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat |
| Antigen | The immunogen for anti-Cited4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PPPPGTLAYGSFGSPVSFQPFPVSQSPGAGSTHLQSAATPSPGRIPAPPA. |
| Description | Rabbit Polyclonal |
| Gene | Cited4 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Cited4 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Heart