| Name | Clarin-1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342660 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-CLRN1 antibody: synthetic peptide directed towards the C terminal of human CLRN1. Synthetic peptide located within the following region: QSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADL. |
| Description | Rabbit Polyclonal |
| Gene | CLRN1 |
| Supplier Page | Shop |