COL22A1 antibody
| Name | COL22A1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331619 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-COL22A1 Antibody is: synthetic peptide directed towards the N-terminal region of Human COL22A1. Synthetic peptide located within the following region: VKEILGKRENGAQSSYVRMGSFPVVQSTEDVFPQGLPDEYAFVTTFRFRK. |
| Description | Rabbit Polyclonal |
| Gene | COL22A1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: COL22A1; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml