Collagen type VI alpha 5 chain antibody
| Name | Collagen type VI alpha 5 chain antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333468 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-COL6A5 Antibody is: synthetic peptide directed towards the C-terminal region of Human COL6A5. Synthetic peptide located within the following region: RNVSLRAKCQGYSIFVFSFGPKHNDKELEELASHPLDHHLVQLGRTHKPD. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | COL6A5 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: COL6A5; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0 ug/ml