COQ2 antibody
| Name | COQ2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341982 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Goat, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish |
| Antigen | The immunogen for anti-COQ2 antibody: synthetic peptide directed towards the middle region of human COQ2. Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML. |
| Description | Rabbit Polyclonal |
| Gene | COQ2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-COQ2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: DU145 cell lysate COQ2 is supported by BioGPS gene expression data to be expressed in DU145