CR1L / CRRY antibody
| Name | CR1L / CRRY antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337759 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human |
| Antigen | The immunogen for anti-CR1L antibody is: synthetic peptide directed towards the N-terminal region of Human CR1L. Synthetic peptide located within the following region: IGTYLNYECRPGYSGRPFSIICLKNSVWTSAKDKCKRKSCRNPPDPVNGM. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | CR1L |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: CR1L; Sample Tissue: ACHN Whole cell lysates; Antibody Dilution: 1.0 ug/ml