CT45A1 antibody

Name CT45A1 antibody
Supplier Acris Antibodies
Catalog TA332257
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-CT45A1 Antibody is: synthetic peptide directed towards the N-terminal region of Human CT45A1. Synthetic peptide located within the following region: VFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAI.
Description Rabbit Polyclonal
Gene CT45A1
Supplier Page Shop

Product images