CXorf23 antibody

Name CXorf23 antibody
Supplier Acris Antibodies
Catalog TA335341
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-CXorf23 Antibody is: synthetic peptide directed towards the C-terminal region of Human CXorf23. Synthetic peptide located within the following region: FHIASAAERDDQNSSFSKNYTTQRKDIITHKPFEVEGNHRNTRVRPFKSN.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene CXorf23
Supplier Page Shop

Product images