CXorf40A antibody
| Name | CXorf40A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331320 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-CXorf40A antibody is: synthetic peptide directed towards the C-terminal region of Human CXorf40A. Synthetic peptide located within the following region: EDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVD. |
| Description | Rabbit Polyclonal |
| Gene | CXorf40A |
| Supplier Page | Shop |
Product images
WB Suggested Anti-CXorf40A Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole CellCXorf40A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells