CXorf48 antibody
| Name | CXorf48 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335533 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-CXorf48 Antibody is: synthetic peptide directed towards the N-terminal region of Human CXorf48. Synthetic peptide located within the following region: ALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESI. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | CT55 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: CXorf48; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml. CXorf48 is supported by BioGPS gene expression data to be expressed in HT1080