CXorf66 antibody

Name CXorf66 antibody
Supplier Acris Antibodies
Catalog TA336103
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-CXorf66 Antibody: synthetic peptide directed towards the middle region of human CXorf66. Synthetic peptide located within the following region: PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene CXorf66
Supplier Page Shop

Product images