CYB5RL antibody
| Name | CYB5RL antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA336043 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-CYB5RL Antibody: synthetic peptide directed towards the N terminal of human LOC606495. Synthetic peptide located within the following region: KLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | CYB5RL |
| Supplier Page | Shop |
Product images
WB Suggested Anti-CYB5RL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HT1080 cell lysate