Cytokeratin 39 / KRT39 antibody
| Name | Cytokeratin 39 / KRT39 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337399 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep |
| Antigen | The immunogen for Anti-KRT39 antibody is: synthetic peptide directed towards the N-terminal region of Human KRT39. Synthetic peptide located within the following region: NFNARFSLDDCSWYGEGINSNEKETMQILNERLANYLQKVRMLERENAEL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | KRT39 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: KRT39; Sample Tissue: RPMI-8226 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml