DCAF17 antibody

Name DCAF17 antibody
Supplier Acris Antibodies
Catalog TA335886
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for Anti-DCAF17 Antibody is: synthetic peptide directed towards the C-terminal region of Human DCAF17. Synthetic peptide located within the following region: IKITDMPPLLFEVSSLENAFQIGGHPWHYIVTPNKKKQKGVFHICALKDN.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene DCAF17
Supplier Page Shop

Product images