Delphilin antibody
| Name | Delphilin antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338301 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for anti-GRID2IP antibody is: synthetic peptide directed towards the middle region of Human GRID2IP. Synthetic peptide located within the following region: CFLGYTAMTAEPEPELDLESEPTPEPQPRSSLRASSMCRRSLRSQGLEAG. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | GRID2IP |
| Supplier Page | Shop |
Product images
WB Suggested Anti-GRID2IP Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell