DGAT2L7P antibody
| Name | DGAT2L7P antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331037 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Yeast |
| Antigen | The immunogen for anti-DGAT2L7 antibody: synthetic peptide directed towards the C terminal of human DGAT2L7. Synthetic peptide located within the following region: FLGRRGLPLPFRAPIRTVVGSAIPVQQSPPPSPAQVDTLQARYVGRLTQL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | DGAT2L7P |
| Supplier Page | Shop |
Product images
WB Suggested Anti-DGAT2L7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: COLO205 cell lysate