DHRS12 antibody
| Name | DHRS12 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335464 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Human, Zebrafish |
| Antigen | The immunogen for Anti-DHRS12 Antibody is: synthetic peptide directed towards the middle region of Human DHRS12. Synthetic peptide located within the following region: FKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | DHRS12 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: DHRS12; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml. DHRS12 is supported by BioGPS gene expression data to be expressed in A549