DMRTC2 antibody
| Name | DMRTC2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329945 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | The immunogen for Anti-Dmrtc2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Dmrtc2. Synthetic peptide located within the following region: SCLAWTSGPSERQLQREAAEALVGLKDSSQAPRLTPSVPPNPAWISLLHP. |
| Description | Rabbit Polyclonal |
| Gene | Dmrtc2 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Dmrtc2; Sample Tissue: Mouse Stomach lysates; Antibody Dilution: 1.0ug/ml