DNAAF2 / KTU antibody
| Name | DNAAF2 / KTU antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA344923 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-C14orf104 antibody: synthetic peptide directed towards the N terminal of human C14orf104. Synthetic peptide located within the following region: MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | DNAAF2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-C14orf104 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate