DNAH12 antibody
| Name | DNAH12 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331519 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Human, Mouse, Rat |
| Antigen | The immunogen for Anti-DNAH12 Antibody is: synthetic peptide directed towards the N-terminal region of Human DNAH12. Synthetic peptide located within the following region: LPENIGVDTPTQSKLLKYRRSKEQQQKINQLVIDGAKRNLDRTLGKRTPL. |
| Description | Rabbit Polyclonal |
| Gene | DNAH12 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: DNAH12; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0ug/ml