DNA helicase B / HELB antibody
| Name | DNA helicase B / HELB antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341626 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Guinea Pig, Human, Pig, Rat |
| Antigen | The immunogen for anti-HELB antibody: synthetic peptide directed towards the N terminal of human HELB. Synthetic peptide located within the following region: FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHI. |
| Description | Rabbit Polyclonal |
| Gene | HELB |
| Supplier Page | Shop |
Product images
WB Suggested Anti-HELB Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate