DNAJA1 / HDJ2 antibody

Name DNAJA1 / HDJ2 antibody
Supplier Acris Antibodies
Catalog TA335012
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for anti-Dnaja1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene Dnaja1
Supplier Page Shop

Product images