DUXA antibody
| Name | DUXA antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342404 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-DUXA antibody: synthetic peptide directed towards the middle region of human DUXA. Synthetic peptide located within the following region: SRLLLQRKREPVASLEQEEQGKIPEGLQGAEDTQNGTNFTSDSHFSGART. |
| Description | Rabbit Polyclonal |
| Gene | DUXA |
| Supplier Page | Shop |
Product images
WB Suggested Anti-DUXA Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Stomach