DZANK1 antibody

Name DZANK1 antibody
Supplier Acris Antibodies
Catalog TA330667
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Dog, Human
Antigen The immunogen for Anti-DZANK1 antibody is: synthetic peptide directed towards the C-terminal region of Human DZANK1. Synthetic peptide located within the following region: KAVNFSDHLLSSAAEGDGGLCGSRSSWVSDYSQSTSDTIEKIKRIKNFKT.
Description Rabbit Polyclonal
Gene DZANK1
Supplier Page Shop

Product images