ECM2 antibody
| Name | ECM2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338285 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-ECM2 antibody is: synthetic peptide directed towards the N-terminal region of Human ECM2. Synthetic peptide located within the following region: FGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTVFTPVARLP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ECM2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ECM2 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole Cell