EFCAB1 antibody
| Name | EFCAB1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335466 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Guinea Pig, Human, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-EFCAB1 Antibody is: synthetic peptide directed towards the middle region of Human EFCAB1. Synthetic peptide located within the following region: EKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEI. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | EFCAB1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: EFCAB1; Sample Tissue: RPMI-8226 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml. EFCAB1 is supported by BioGPS gene expression data to be expressed in RPMI 8226