EFCAB5 antibody

Name EFCAB5 antibody
Supplier Acris Antibodies
Catalog TA335337
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-EFCAB5 Antibody is: synthetic peptide directed towards the C-terminal region of Human EFCAB5. Synthetic peptide located within the following region: TEPNSPQDSKSMELEANVKLVRDILKAVILFFHPELEFSSDFGSWDKCKF.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene EFCAB5
Supplier Page Shop

Product images