EFCC1 antibody
| Name | EFCC1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330752 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | The immunogen for Anti-CCDC48 antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC48. Synthetic peptide located within the following region: LEAELQRYRSEDSQLPTPQLANPEPGDKSNEPEDAGTRDPDPTPEGAWQS. |
| Description | Rabbit Polyclonal |
| Gene | EFCC1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: CCDC48; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml