EFR3B antibody

Name EFR3B antibody
Supplier Acris Antibodies
Catalog TA335604
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rat
Antigen The immunogen for Anti-EFR3B Antibody is: synthetic peptide directed towards the C-terminal region of Human EFR3B. Synthetic peptide located within the following region: PQLTDEDRLSKRRSIGETISLQVEVESRNSPEKEERVPAEEITYETLKKA.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene EFR3B
Supplier Page Shop

Product images