EFR3B antibody
| Name | EFR3B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335605 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-EFR3B Antibody is: synthetic peptide directed towards the N-terminal region of Human EFR3B. Synthetic peptide located within the following region: VPSLLFNLQHVEEAESRSPSPLQAPEKEKESPAELAERCLRELLGRAAFG. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | EFR3B |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: EFR3B; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml. EFR3B is strongly supported by BioGPS gene expression data to be expressed in Human A549 cells