EIF4E1B antibody
| Name | EIF4E1B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334102 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-EIF4E1B Antibody is: synthetic peptide directed towards the N-terminal region of Human EIF4E1B. Synthetic peptide located within the following region: EKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRWA. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | EIF4E1B |
| Supplier Page | Shop |
Product images
WB Suggested Anti-EIF4E1B Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart