ESX1 antibody
| Name | ESX1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341760 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | The immunogen for anti-ESX1 antibody: synthetic peptide directed towards the N terminal of mouse ESX1. Synthetic peptide located within the following region: MESHKKCPCCYCTDLKTFVGAVKEETLQDPQPSLSSTLLEGADYQENAES. |
| Description | Rabbit Polyclonal |
| Gene | Esx1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ESX1 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Testis