FAHD1 antibody
| Name | FAHD1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332254 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Guinea Pig, Human, Mouse, Rat, Yeast, Zebrafish |
| Antigen | The immunogen for Anti-FAHD1 Antibody is: synthetic peptide directed towards the middle region of Human FAHD1. Synthetic peptide located within the following region: EAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVP. |
| Description | Rabbit Polyclonal |
| Gene | FAHD1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: FAHD1; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0ug/ml