FAM13A1 antibody
| Name | FAM13A1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335609 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-FAM13A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM13A. Synthetic peptide located within the following region: DFEDNFFRQNGRNVQKEDRTPMAEEYSEYKHIKAKLRLLEVLISKRDTDS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | FAM13A |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: FAM13A; Sample Tissue: OVCAR-3 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml