FAM18B2 antibody
| Name | FAM18B2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330862 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-TVP23C antibody is: synthetic peptide directed towards the middle region of Human TVP23C. Synthetic peptide located within the following region: RWWNHIDEDGKSHWVFESRKESSQENKTVSEAESRIFWLGLIACSVLWVI. |
| Description | Rabbit Polyclonal |
| Gene | TVP23C |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TVP23C; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/ml