FAM18B2 antibody
| Name | FAM18B2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335391 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Rabbit, Rat |
| Antigen | The immunogen for Anti-TVP23C Antibody is: synthetic peptide directed towards the N-terminal region of Human TVP23C. Synthetic peptide located within the following region: FWAVKNVTGRLMVGLRWWNHIDEDGKSHWVFESRKESSQENKTVSEAESR. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | TVP23C |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TVP23C; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0 ug/ml