FAM19A4 antibody
| Name | FAM19A4 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335352 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Pig, Rat |
| Antigen | The immunogen for Anti-Fam19a4 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Fam19a4. Synthetic peptide located within the following region: VIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEA. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | FAM19A4 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Fam19a4 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Kidney