FAM32A antibody
| Name | FAM32A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335635 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Pig, Rat |
| Antigen | The immunogen for Anti-FAM32A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM32A. Synthetic peptide located within the following region: DKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKAS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | FAM32A |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: FAM32A; Sample Tissue: HCT15 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml. FAM32A is supported by BioGPS gene expression data to be expressed in HCT15