FAM47E antibody
| Name | FAM47E antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330866 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | The immunogen for Anti-FAM47E antibody is: synthetic peptide directed towards the middle region of Human FAM47E. Synthetic peptide located within the following region: KLEDTWAYCQDTRKGMKEPTKLLKKHSTQVYLGPSKKTSVSNAGQWLYEE. |
| Description | Rabbit Polyclonal |
| Gene | FAM47E |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: FAM47E; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0ug/ml